


| Basic Information | |
|---|---|
| Taxon OID | 3300010033 Open in IMG/M |
| Scaffold ID | Ga0126339_10290924 Open in IMG/M |
| Source Dataset Name | Coral microbial communities from Petempiche,Puerto Morelos, Mexico - Orbicella T R C metagenome |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 785 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Petempiche,Puerto Morelos, Mexico | |||||||
| Coordinates | Lat. (o) | 20.9047 | Long. (o) | -86.8366 | Alt. (m) | Depth (m) | 8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071955 | Metagenome / Metatranscriptome | 121 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0126339_102909241 | F071955 | N/A | MDEFTGKDETFVELWLVRQGLEKLVDVFKGVFSEF* |
| ⦗Top⦘ |