


| Basic Information | |
|---|---|
| Taxon OID | 3300010023 Open in IMG/M |
| Scaffold ID | Ga0130028_103931 Open in IMG/M |
| Source Dataset Name | Terrestrial hot spring microbial mat viral communities from Octopus Spring, Yellowstone National Park, Wyoming (2009) spADES assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Duke University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 695 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Terrestrial Hot Spring Microbial Mat → Terrestrial Hot Spring Microbial Mat Viral Communities From Octopus Spring, Yellowstone National Park, Wyoming |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming | |||||||
| Coordinates | Lat. (o) | 44.53408 | Long. (o) | -110.7979 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000642 | Metagenome / Metatranscriptome | 965 | Y |
| F002978 | Metagenome / Metatranscriptome | 516 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0130028_1039311 | F002978 | AGG | VSMRDWRVTIVPWADRRLWFLQARRGRRVVWGIVYDAGDPDSVALARRAIATLRAAGADCSALPASLPGAPPGAPGA* |
| Ga0130028_1039312 | F000642 | N/A | IALALCAVAAAVWYMRRRDAGSARVRGWLLLYDDLGGWRALPAAYSDSGVVADGVTYPASLPVLRVDRTLIWIARCDAAALIEHQALERARESAALASLWRGGGQWIDLLRVMGVVLPAVFAYFTWAQVSSLQALVARILVLVGDK* |
| ⦗Top⦘ |