


| Basic Information | |
|---|---|
| Taxon OID | 3300009967 Open in IMG/M |
| Scaffold ID | Ga0133780_1007875 Open in IMG/M |
| Source Dataset Name | Termite gut microbial communities -laboratory nest Belgium. Combined Assembly of Gp0151224, Gp0151225, Gp0151226, Gp0151227 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Luxembourg Institute of Science and Technology |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 529 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Belgium | |||||||
| Coordinates | Lat. (o) | 50.814939 | Long. (o) | 4.383499 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007951 | Metagenome | 342 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0133780_10078751 | F007951 | N/A | FRPFWEMFCEQQDNSVIHAFHMGKYMLHAQESETLQTFTFRLLKGKQRTSVTFQTDSNIPISLHVFAFLLIVEEDIVFIHDAAFFFLGVCAFA* |
| ⦗Top⦘ |