NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0130077_11251575

Scaffold Ga0130077_11251575


Overview

Basic Information
Taxon OID3300009871 Open in IMG/M
Scaffold IDGa0130077_11251575 Open in IMG/M
Source Dataset NameCow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Rumen Fluid.Combined Assembly of Gp0148671, Gp0148672
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterU.S. Department of Energy (DOE)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)676
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Cow Rumen Metatranscriptome

Source Dataset Sampling Location
Location NameUniversity of Illinois at Urbana - Champaign, Illinois, USA
CoordinatesLat. (o)40.096Long. (o)-88.2315Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033664Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
Ga0130077_112515751F033664N/AYLPETKQTISFQFPKITMGGALWGERYVYFSDHMKFEDRGNNLKCVIAFANNRKELKGKRIHDIYGRIFNYDYVANLDDPDPFYSDSMSSHPFPLYNKDIVSEITGSWLEEVKFDNKVYFNIKKSSPPQIYPCKKVLNSDSRYREDKEWLQLSWDNKEKAKLYEEYAQAWKLALEAQQRYERGLRKEFATNAKKA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.