


| Basic Information | |
|---|---|
| Taxon OID | 3300009788 Open in IMG/M |
| Scaffold ID | Ga0114923_10257544 Open in IMG/M |
| Source Dataset Name | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1263 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | near North Sumatra | |||||||
| Coordinates | Lat. (o) | 1.759 | Long. (o) | 96.774 | Alt. (m) | Depth (m) | 1855 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F093897 | Metagenome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114923_102575442 | F093897 | N/A | VKPGFYISMGIAIAALAVGFILLADIEQEEEIQTIWIQKTPTQCNDVWEEEYNEFYKINPEIKGLTKEESKNISENIIKSHYEKQGIEILDVNLELEVYEGVRCEACNCLGWDRLSIKIPENELELIPENEGWEPKS* |
| ⦗Top⦘ |