


| Basic Information | |
|---|---|
| Taxon OID | 3300009777 Open in IMG/M |
| Scaffold ID | Ga0105164_10338338 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 749 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Netherlands | |||||||
| Coordinates | Lat. (o) | 52.2278 | Long. (o) | 5.919 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079717 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0105164_103383381 | F079717 | GAG | MVYISEEAHQRLKLLAARRNRPMGQVVQDLVEQELVDLVNPWTSQEGLLLQQHVLARVWDDPALDAYDHD* |
| ⦗Top⦘ |