


| Basic Information | |
|---|---|
| Taxon OID | 3300009763 Open in IMG/M |
| Scaffold ID | Ga0123340_1021015 Open in IMG/M |
| Source Dataset Name | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5023 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodule → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mexico: Nepantla | |||||||
| Coordinates | Lat. (o) | 19.09098 | Long. (o) | -98.87936 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096732 | Metagenome | 104 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0123340_10210153 | F096732 | AGG | MQASMEVELDETLKHRIEEVDETPHDAEAMEMQGKKHARRLLVK* |
| ⦗Top⦘ |