


| Basic Information | |
|---|---|
| Taxon OID | 3300009762 Open in IMG/M |
| Scaffold ID | Ga0116130_1226215 Open in IMG/M |
| Source Dataset Name | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 593 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota | |||||||
| Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | .4 to .5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045222 | Metagenome / Metatranscriptome | 153 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116130_12262151 | F045222 | GAG | VGTTPNSARGADLAERVRSILRSKHLTLSKVSLLSAAPFGRSSRYFLPHTLYHEFQLGTFSPSLHQVFALSQVSGYRFFDWLRVLGCDLEDIPRLQVLLPSKRTMLLDSSLVDADAWIPWFRNRPRSASAPPIAPLGQLLEVTAPRRLRSLSEIGNRGFLYARIGRQDALAFPDLIPGSI |
| ⦗Top⦘ |