


| Basic Information | |
|---|---|
| Taxon OID | 3300009720 Open in IMG/M |
| Scaffold ID | Ga0116159_1143272 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1030 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa → unclassified Candidatus Methanofastidiosa → Candidatus Methanofastidiosa archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan | |||||||
| Coordinates | Lat. (o) | 43.77 | Long. (o) | 142.37 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F037746 | Metagenome / Metatranscriptome | 167 | N |
| F074119 | Metagenome / Metatranscriptome | 120 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116159_11432721 | F074119 | N/A | LVSLGIGAFAGWELVKTKIHELAEFFKTVDEALYDDAVTEKEFRAIWEKGRVLFQWSFTAKKGEL* |
| Ga0116159_11432723 | F037746 | GGAGG | MPVDIEWAKASDTVGQEFESNYIPGTTDKDLEDARAVMEKLLKKYGGRDALEADERDWAKYKRAMYVVASRSKDTMDRANKAREELIKRKNLLSQFFDGNREILFKLPEWARINLRKYTDYGLLVDQEYLWQALGELGEDGLIEHLLNVANYIYLDTGFLGGTREDYDALQKGPIRSIYHRSACKAQKTVHPDCGSGCNKV* |
| ⦗Top⦘ |