


| Basic Information | |
|---|---|
| Taxon OID | 3300009673 Open in IMG/M |
| Scaffold ID | Ga0116185_1426303 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 549 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Japan | |||||||
| Coordinates | Lat. (o) | 37.43 | Long. (o) | 138.83 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049017 | Metagenome / Metatranscriptome | 147 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116185_14263031 | F049017 | N/A | MAIAKYSKTCGKNVPGNSRLFFVEAANISSITVTSNEISAVTMSNTAKFCEFGADIDSIKFTIEGTGSASYSEVQKLEAKFSKKKTALITAKNSLLDAVACGVAIIRVDNNGSAWLSGYTLKDKNRRAYNKITTNFDTGAKPSDEGTAAYTITL |
| ⦗Top⦘ |