


| Basic Information | |
|---|---|
| Taxon OID | 3300009520 Open in IMG/M |
| Scaffold ID | Ga0116214_1092037 Open in IMG/M |
| Source Dataset Name | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1113 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Germany: Weissenstadt | |||||||
| Coordinates | Lat. (o) | 50.1318 | Long. (o) | 11.881 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008260 | Metagenome / Metatranscriptome | 336 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0116214_10920372 | F008260 | GGAGG | MGRAAASRAEEDPGALEELEFHWGSAYHIAVVDGMYTARRMDGRGGLLADPLPAGLRLRIQADYAAMPVPRDLP* |
| ⦗Top⦘ |