


| Basic Information | |
|---|---|
| Taxon OID | 3300009502 Open in IMG/M |
| Scaffold ID | Ga0114951_10306194 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 815 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium SCN 57-15 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Lake Alinen Mustajarvi | |||||||
| Coordinates | Lat. (o) | 61.2 | Long. (o) | 25.1 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063031 | Metagenome / Metatranscriptome | 130 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114951_103061942 | F063031 | N/A | FILLYICTLFGMGLLLKEGYGFFQLYQLKVQALRTAEQATRDIAALNQTLVENRRTQNSYEQFKYRQRTIARPGPLLDWLPTLVGRAQRAHFISLQQANDRVNVRVTLEKAIADSVIQNPAPPPDYQIVQSGEETPKYQELPTNQRPSPKNEYAAFAAQLKKP* |
| ⦗Top⦘ |