


| Basic Information | |
|---|---|
| Taxon OID | 3300009468 Open in IMG/M |
| Scaffold ID | Ga0127530_141853 Open in IMG/M |
| Source Dataset Name | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas, Austin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1236 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Rosa → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tucson, AZ, USA | |||||||
| Coordinates | Lat. (o) | 32.23184 | Long. (o) | -110.950699 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029983 | Metagenome | 186 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127530_1418531 | F029983 | GGTGG | VSICCTIGYKWVTIIDVVKFEFNDKKSLYKKNASKRRLSV |
| ⦗Top⦘ |