NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114993_10969011

Scaffold Ga0114993_10969011


Overview

Basic Information
Taxon OID3300009409 Open in IMG/M
Scaffold IDGa0114993_10969011 Open in IMG/M
Source Dataset NameMarine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)606
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean: Canada Basin
CoordinatesLat. (o)73.2247Long. (o)-150.2247Alt. (m)Depth (m)177
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001541Metagenome / Metatranscriptome674Y

Sequences

Protein IDFamilyRBSSequence
Ga0114993_109690112F001541AGGAGMAFDAVQVRFKGTPQVKSPFANTRVVPFVDSYFEVLKSVVDDVKTEYFWLFASFVNMNTGNFLDYIPEQHEKDQVHVWYTTHPMGGLNKEGNVFLIPTKKFK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.