


| Basic Information | |
|---|---|
| Taxon OID | 3300009388 Open in IMG/M |
| Scaffold ID | Ga0103809_1004612 Open in IMG/M |
| Source Dataset Name | Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of California, San Diego |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2745 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Metatranscriptome Sequencing Of An Anaerobic Hexadecane-degrading Microbial Consortia From University Of California, San Diego, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | UCSD, USA | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056321 | Metagenome / Metatranscriptome | 137 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103809_10046123 | F056321 | GGAG | MPHMEAPATPPVIYVHVEFYRGVKAIAKFLGVHERTAQAFLHDGKIPGKKDGTGTWVLTNLDYFTSLQR* |
| ⦗Top⦘ |