


| Basic Information | |
|---|---|
| Taxon OID | 3300009122 Open in IMG/M |
| Scaffold ID | Ga0118674_1043459 Open in IMG/M |
| Source Dataset Name | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C13.But.B IBDA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1105 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge → Syntrophic Microbial Communities From Biogas Reactors In Seattle, Wa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Seattle, WA | |||||||
| Coordinates | Lat. (o) | 47.652555 | Long. (o) | -122.304991 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F101100 | Metagenome / Metatranscriptome | 102 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0118674_10434594 | F101100 | GAGG | MKLVFRVESANEEIIRGGWYLLADSLAAAREVYPAHVFPSMTFVEVGKGLCVECNRRAVDALVEE* |
| ⦗Top⦘ |