


| Basic Information | |
|---|---|
| Taxon OID | 3300009070 Open in IMG/M |
| Scaffold ID | Ga0066256_1002017 Open in IMG/M |
| Source Dataset Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (version 2) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 24150 |
| Total Scaffold Genes | 28 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 19 (67.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Cape Town, South Africa | |||||||
| Coordinates | Lat. (o) | -33.927 | Long. (o) | 18.452665 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013535 | Metagenome / Metatranscriptome | 270 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0066256_100201717 | F013535 | GGAGG | MTFEFSLLIVYRLLAFGVAAAMVWVVLRDRDWRSQVFAAMVMIPFALRAAGLK* |
| ⦗Top⦘ |