NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103928_10359446

Scaffold Ga0103928_10359446


Overview

Basic Information
Taxon OID3300009023 Open in IMG/M
Scaffold IDGa0103928_10359446 Open in IMG/M
Source Dataset NamePlanktonic microbial communities from coastal waters of California, USA - Canon-29
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Hawaii
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)558
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water → Planktonic Microbial Communities From Coastal Waters Of California, Usa

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001939Metatranscriptome614Y

Sequences

Protein IDFamilyRBSSequence
Ga0103928_103594461F001939AGAAGGMKTAVAAMVAALALTGHMPVSSASLLRRRDSPEEISMDMEYRDQDSFGNTALTPACSKVECGEYSCPAPFELKVDGTCCGYCWAPDHQLAVDRHQVKAFNSTGLAVEQCEEAPSTCKGPGANAVRCFKPMCRAGETPNCAPGSCCAMCSGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.