


| Basic Information | |
|---|---|
| Taxon OID | 3300008935 Open in IMG/M |
| Scaffold ID | Ga0103738_1000692 Open in IMG/M |
| Source Dataset Name | Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3A |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2554 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica → Eukaryotic And Microbial Communities From Ice Edge, Mcmurdo Sound, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ice edge, McMurdo Sound, Antarctica | |||||||
| Coordinates | Lat. (o) | -77.36 | Long. (o) | 164.28 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056538 | Metatranscriptome | 137 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103738_10006921 | F056538 | GAG | MATERLVGDARVLHNVPLSDTMRCAFALATLVAVSDANEITPVQKVIEMMNGMMEKGKKEKHDEQVQFAAFKQFCDDTSAEKKQNIEDAADSIEMLKADIQQYATDAKELGKKVQGLRADVACWEGDIKAATKVREIEKSDYQQRCHRRIA* |
| ⦗Top⦘ |