


| Basic Information | |
|---|---|
| Taxon OID | 3300008707 Open in IMG/M |
| Scaffold ID | Ga0115605_102304 Open in IMG/M |
| Source Dataset Name | Human palatine tonsils microbial communities from NIH, USA - visit 1, subject 763577454 reassembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1892 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Oral Cavity → Palatine Tonsils → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | National Institutes of Health, USA | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033081 | Metagenome | 178 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115605_1023043 | F033081 | N/A | TEIENAGYFSRRKFSILAVGLIIMTIATIKMLLFVPGLNQSVVSLLTRGLETFLPAGWATGAAWTVGMTGVFLMGNFTNYTPSQRFLHKTKATRCEAYNTLLLLALWEEQAFRAGSEKWSWRERVRASMCFGLAHIVNIWYSFAAGIALSVTGFGFLLVYLWYYRKYRSQIIATAAAATVHALYNAIALSLIAVVLAIDIAKLL* |
| ⦗Top⦘ |