


| Basic Information | |
|---|---|
| Taxon OID | 3300008698 Open in IMG/M |
| Scaffold ID | Ga0103619_100294 Open in IMG/M |
| Source Dataset Name | Microbial communities of saline water collected from the North Sea in Germany - HE327_3b |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Goettingen Genomics Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1234 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Sea, Germany | |||||||
| Coordinates | Lat. (o) | 54.4223 | Long. (o) | 7.6833 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047922 | Metagenome / Metatranscriptome | 149 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103619_1002943 | F047922 | GAGG | MTPQEIVAHKNKWRMASYFVSHTHSDLRSEATQWCKDHCFQWRYDIKHFTDIYGDTVRFELEEDFNAFNEWYQERMYG* |
| ⦗Top⦘ |