


| Basic Information | |
|---|---|
| Taxon OID | 3300008661 Open in IMG/M |
| Scaffold ID | Ga0103653_100662 Open in IMG/M |
| Source Dataset Name | Microbial communities of corn rhizosphere soil from Ohio, USA - Corn_Control_1a |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Auburn University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 578 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities Of Corn And Soybean Rhizosphere Soil From Ohio, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Ohio, USA | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001679 | Metagenome / Metatranscriptome | 653 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103653_1006622 | F001679 | AGG | MSRRQKAMKGVEGCDKLGEAVKQALIPGYPNHSMLNT* |
| ⦗Top⦘ |