


| Basic Information | |
|---|---|
| Taxon OID | 3300008644 Open in IMG/M |
| Scaffold ID | Ga0103608_1000730 Open in IMG/M |
| Source Dataset Name | Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-08-50 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1499 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025846 | Metagenome / Metatranscriptome | 200 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103608_10007303 | F025846 | N/A | MASVSMPHGSVMDMQTVQMVVMKLTVLLHHVKTRVYGIVVMDNASLHPMYVMAQVNFVTQAGLLTVPMVQMKA* |
| ⦗Top⦘ |