


| Basic Information | |
|---|---|
| Taxon OID | 3300008463 Open in IMG/M |
| Scaffold ID | Ga0115335_128366 Open in IMG/M |
| Source Dataset Name | Deep sea sediment microbial communities from the Gulf of Mexico ? control with no oil added |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas, Austin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1198 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Methylohalomonas → Methylohalomonas lacus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Sediment → Deep Sea Sediment Microbial Communities From The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Gulf of Mexico | |||||||
| Coordinates | Lat. (o) | 28.0 | Long. (o) | -88.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028812 | Metagenome | 190 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115335_1283663 | F028812 | N/A | MDPDLENVIRQALGDALAAGKDHLSQTELAVRAVQRARPDMTASDALVAVNLARRE* |
| ⦗Top⦘ |