


| Basic Information | |
|---|---|
| Taxon OID | 3300008460 Open in IMG/M |
| Scaffold ID | Ga0115203_116023 Open in IMG/M |
| Source Dataset Name | Microbial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas, Austin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1236 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Sagebrush → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Onefour, Alberta, CA | |||||||
| Coordinates | Lat. (o) | 49.115537 | Long. (o) | -110.468757 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029983 | Metagenome | 186 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0115203_1160231 | F029983 | GAGG | MLLCCTVGYKWIHCLMDGITFEFNDIILCIKNDSVLRRFV |
| ⦗Top⦘ |