


| Basic Information | |
|---|---|
| Taxon OID | 3300008450 Open in IMG/M |
| Scaffold ID | Ga0114880_1040403 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2027 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Viral Communities During Cyanobacterial Harmful Algal Blooms (Chabs) In Western Lake Erie, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Western Lake Erie | |||||||
| Coordinates | Lat. (o) | 41.7032 | Long. (o) | -83.2575 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001326 | Metagenome / Metatranscriptome | 721 | Y |
| F009743 | Metagenome / Metatranscriptome | 313 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114880_10404031 | F009743 | AGGAG | MKIKLQLKRTPDSAPEYYYTNLFVVTEWERLERRNIQQLSASPLYSDYCCWMHTILKIKGEQVGDNWRDWISKNPDIDILPVLDETDPNPTDAAPTVAS* |
| Ga0114880_10404034 | F001326 | GGAG | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYSVRALPQYLFLGIDTQGDLLYDYQIPIADQVLYAKTANDVERVAATGTVANDPVCTWVTAAQVMTYLGITITNPSDDYTLLTQSVSAGNQFCYRRRQESGYIDSLTTSPGGDATLGTLMYCAALWRSRGSIEATYATFDGMGSAPQQSLTPIVKQLLGIPRPAVA* |
| ⦗Top⦘ |