NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114876_1139806

Scaffold Ga0114876_1139806


Overview

Basic Information
Taxon OID3300008448 Open in IMG/M
Scaffold IDGa0114876_1139806 Open in IMG/M
Source Dataset NameFreshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Michigan
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)899
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Spongiibacteraceae → unclassified Spongiibacteraceae → Spongiibacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Viral Communities During Cyanobacterial Harmful Algal Blooms (Chabs) In Western Lake Erie, Usa

Source Dataset Sampling Location
Location NameWestern Lake Erie
CoordinatesLat. (o)41.7032Long. (o)-83.2575Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001354Metagenome / Metatranscriptome716Y

Sequences

Protein IDFamilyRBSSequence
Ga0114876_11398061F001354N/ASFLFEAYKENKKLPMIAEDRAEDVVAHLFKNTDATVIAIFKVNPLFGTRVLFRAYTREGRDKTHDGLDVGLFTQSSGNNRDVIALMANEIPCSEYAIAQSEIGLWYIEKGVTFGCRVSVPPEQGRFVGQITVGWDKEPKDLTKAISMLQIASNMLSRSKQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.