


| Basic Information | |
|---|---|
| Taxon OID | 3300008221 Open in IMG/M |
| Scaffold ID | Ga0114916_1117318 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 626 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | West Anvers Island | |||||||
| Coordinates | Lat. (o) | -64.45 | Long. (o) | -64.88 | Alt. (m) | Depth (m) | 4 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011493 | Metagenome | 290 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114916_11173182 | F011493 | AGGAGG | MPNDLVKTQSINNVDITPVLKEVIEYSKDQASIGNIEELISKVPMKESLDWKLLSGVLCNSLIEWVAEDKANRLDLIKHIQGDIGYVLKRMGLTM* |
| ⦗Top⦘ |