


| Basic Information | |
|---|---|
| Taxon OID | 3300008113 Open in IMG/M |
| Scaffold ID | Ga0114346_1022766 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Michigan |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3353 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton → Harmful Algal Blooms In Lake Erie |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erie, USA | |||||||
| Coordinates | Lat. (o) | 41.8271 | Long. (o) | -83.1945 | Alt. (m) | Depth (m) | 8 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F044369 | Metagenome / Metatranscriptome | 154 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114346_10227665 | F044369 | N/A | MSKIEHILHKAHKKGIYNETMSLAQEVKKEDPKIEIEDRYEIAYERAKKSLLKSSPPLNP |
| ⦗Top⦘ |