


| Basic Information | |
|---|---|
| Taxon OID | 3300007538 Open in IMG/M |
| Scaffold ID | Ga0099851_1246548 Open in IMG/M |
| Source Dataset Name | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 640 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chesapeake Bay, USA | |||||||
| Coordinates | Lat. (o) | 37.0516 | Long. (o) | -76.083 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005496 | Metagenome / Metatranscriptome | 399 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099851_12465482 | F005496 | GAGG | MNIDSKTISIIMAIVIQSVSLVWFISKMDSRIANNERDMQRIMEMHKDYDKMQKQIDRISWLLDADAR |
| ⦗Top⦘ |