


| Basic Information | |
|---|---|
| Taxon OID | 3300007334 Open in IMG/M |
| Scaffold ID | Ga0079269_1480541 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S12 Surf_A metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1776 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Atlantic ocean | |||||||
| Coordinates | Lat. (o) | -28.2362 | Long. (o) | -38.4949 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013897 | Metagenome / Metatranscriptome | 267 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079269_14805414 | F013897 | GAGG | MSFTKDQLLALMNTIDFATDNDASYEEYTILQSGTSDLEPIRDILYNEYIHQT* |
| ⦗Top⦘ |