NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066366_10341286

Scaffold Ga0066366_10341286


Overview

Basic Information
Taxon OID3300007283 Open in IMG/M
Scaffold IDGa0066366_10341286 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)642
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)-0.015038Long. (o)-22.962334Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002768Metagenome / Metatranscriptome531Y

Sequences

Protein IDFamilyRBSSequence
Ga0066366_103412862F002768AGGAGMSKRSWWSLKIDDYPNFKPTDEDLEHIAEQIKQGNHQGELIQEDEG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.