


| Basic Information | |
|---|---|
| Taxon OID | 3300007238 Open in IMG/M |
| Scaffold ID | Ga0080112_1012462 Open in IMG/M |
| Source Dataset Name | Non-marine hypersaline water viral communities from Salar Uyuni, Bolivia - ZN24 UYUNI 14 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 972 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salar Of Uyuni 2014 (Chile) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Salar Uyuni Bolivia | |||||||
| Coordinates | Lat. (o) | -20.333333 | Long. (o) | -67.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F079661 | Metagenome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0080112_10124622 | F079661 | N/A | MTRTTIEIPESVRDQLKEERKSHESNYGDTIERLLGESSGGQLWTEQELRDMISREIEKAQRGR* |
| ⦗Top⦘ |