


| Basic Information | |
|---|---|
| Taxon OID | 3300007214 Open in IMG/M |
| Scaffold ID | Ga0103959_1109744 Open in IMG/M |
| Source Dataset Name | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface layer) 9 sequencing projects |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Singapore Centre on Environmental Life Sciences Engineering (SCELSE), The Singapore Centre on Environmental Life Sciences Engineering |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5142 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Cyanobacterial Bloom In Punggol Reservoir, Singapore (Diel Cycle) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.409238 | Long. (o) | 103.907928 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F066595 | Metagenome | 126 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103959_11097446 | F066595 | AGGA | MIQLLATTYIIAKYIPKPKWLMRKPFTCPLCLTYWSFLIYQIINFTTYFDLITIPFTFALLASLIEQINDRYLL* |
| ⦗Top⦘ |