


| Basic Information | |
|---|---|
| Taxon OID | 3300007168 Open in IMG/M |
| Scaffold ID | Ga0099838_101909 Open in IMG/M |
| Source Dataset Name | Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_top_diel_T=7 metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1157 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.7315 | Long. (o) | -110.7113 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021808 | Metagenome / Metatranscriptome | 217 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099838_1019091 | F021808 | N/A | MNEEPPYGTMAWFFYEIDERQRQIYELVFDIDQKLAKVKNLLNEIDILKAQLETNVNVGKI* |
| ⦗Top⦘ |