


| Basic Information | |
|---|---|
| Taxon OID | 3300007166 Open in IMG/M |
| Scaffold ID | Ga0099835_126153 Open in IMG/M |
| Source Dataset Name | Iron oxide microbial mat communities from Yellowstone National Park, Wyoming, USA - BED_top_diel_T=1 metaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1062 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Yellowstone National Park, Wyoming | |||||||
| Coordinates | Lat. (o) | 44.7315 | Long. (o) | -110.7113 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027904 | Metagenome / Metatranscriptome | 193 | N |
| F067921 | Metagenome / Metatranscriptome | 125 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0099835_1261531 | F067921 | N/A | YTGVLALQETFSRIEDRILRNGQYLLVSYSSSQHPDESSYTGFRVTKHNFTTLYYNFATEVSNFLPMAPFGGQASSTTSPPYITNFKFSLQLVQNVTDMFDLSRNYDAYQVFYGIAPSYLRTMLQIQQQFIAVLEQNINPSQSFVEMGIDGFQSPLFAPDPRTEFIVFSNLTYNMTLMNTATIPIMPAFNFVINRMTLEPLSKQEIKKAILAGFPVRTLGAVDSAIPVSRDNYPGLQTVTYKEVYGGGS* |
| Ga0099835_1261532 | F027904 | GGAGG | VECKYDPPTYDLFNLNNGSTLVGQSPVTLLYEGQPNAAVYAPPDLTLRAKQIIIQNATTSPITVQLLAVAAPNTSLPGPIPKTPPIPVNAGSAVTLSEEEWGI |
| ⦗Top⦘ |