


| Basic Information | |
|---|---|
| Taxon OID | 3300007154 Open in IMG/M |
| Scaffold ID | Ga0101548_1082600 Open in IMG/M |
| Source Dataset Name | Marine sponge Stylissa sp. associated microbial community from CO2 seep in Upa-Upasina, Papua New Guinea - St7is |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of New South Wales |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 611 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Stylissa Sp. (Marine Sponge) → Seawater And Marine Sponges Microbial Communities From Papua New Guinea Co2 Seeps |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Upa-Upasina, Papua New Guinea | |||||||
| Coordinates | Lat. (o) | -0.940556 | Long. (o) | 150.816667 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F068499 | Metagenome / Metatranscriptome | 124 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101548_10826001 | F068499 | N/A | SYSLVGSEMYSIREFLAFYSHFQVTFGQMTSLPGHYRSTEVT* |
| ⦗Top⦘ |