


| Basic Information | |
|---|---|
| Taxon OID | 3300007094 Open in IMG/M |
| Scaffold ID | Ga0102532_1056386 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3097 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Singapore - A Non-Axenic Oscillatoriales Culture (M13A) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.3991438 | Long. (o) | 103.77518 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003377 | Metagenome / Metatranscriptome | 490 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102532_10563864 | F003377 | GGAGG | VTDAARETLYGIIERWGFPTLVALALGYFLRTDILLPMLDEHRLTLKEIRETQREIAKAVSEQTRLLYALQPRNEKTMTVSATQELEKN* |
| ⦗Top⦘ |