


| Basic Information | |
|---|---|
| Taxon OID | 3300006999 Open in IMG/M |
| Scaffold ID | Ga0102676_110959 Open in IMG/M |
| Source Dataset Name | Non-marine hypersaline water viral communities from A?ana, Logroño, Spain -Vir_A?ana_2_PRE |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Alicante |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 569 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Añana | |||||||
| Coordinates | Lat. (o) | 42.80111387 | Long. (o) | -2.985507 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000388 | Metagenome / Metatranscriptome | 1201 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102676_1109591 | F000388 | N/A | MKVIKVTKEYYETEDEKVYFFEPLEKEISVEDMQKIVDINEKLIKEIKNGK |
| ⦗Top⦘ |