


| Basic Information | |
|---|---|
| Taxon OID | 3300006957 Open in IMG/M |
| Scaffold ID | Ga0102533_10753 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Singapore - a non-axenic P13C2 culture |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Singapore Centre on Environmental Life Sciences Engineering |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 9512 |
| Total Scaffold Genes | 16 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (62.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From Singapore - A Non-Axenic P13C2 Culture |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Singapore | |||||||
| Coordinates | Lat. (o) | 1.376759 | Long. (o) | 103.898487 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082218 | Metagenome | 113 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0102533_1075310 | F082218 | N/A | MSGTLPLREAALAAIAERIITGLPDVALDRARRAPVDVEAETLPRLVLRGEEIEADDTEEPGRTHYRIGFVVSGFAAAASDLAAEQALSTLHARLVSLLAGWTPAAPGLGDVVEQGAEFRMYDTEESALPAGEFLARFSILAIGPNGGPWSA* |
| ⦗Top⦘ |