NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0099825_1018578

Scaffold Ga0099825_1018578


Overview

Basic Information
Taxon OID3300006941 Open in IMG/M
Scaffold IDGa0099825_1018578 Open in IMG/M
Source Dataset NameRoot nodule microbial communities of legume samples collected from California, USA - Siratro red BW
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5382
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location
Location NameCalifornia, USA
CoordinatesLat. (o)34.0722Long. (o)-118.4441Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056359Metagenome137Y

Sequences

Protein IDFamilyRBSSequence
Ga0099825_10185785F056359N/AMFSIF*QVWIGEMGKKDYQNTKRIKKTNSKRWNL*GILDFKCLYFLLKYSTIFQNSLIKSLIYKIKKHKNF*
Ga0099825_10185788F056359N/AMFRIF*QVWIGEIGKKDYQNAKKLRKTNSKRWNL*RILDFKCVYLLEKYFMIFQNSLIKSLIHKIKKYKNF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.