


| Basic Information | |
|---|---|
| Taxon OID | 3300006735 Open in IMG/M |
| Scaffold ID | Ga0098038_1045179 Open in IMG/M |
| Source Dataset Name | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1605 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -12.999 | Long. (o) | -80.801 | Alt. (m) | Depth (m) | 30 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014070 | Metagenome / Metatranscriptome | 266 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0098038_10451793 | F014070 | AGGAG | MKNLSMKTLITYSILVLGLFGIVRADETTTTGVSVSGEFSTDITFGDATTFASPYTGLTLSGDGWVVSTNLSDGMVNIEEAKYSWNVVDGVTLTFGSQ |
| ⦗Top⦘ |