


| Basic Information | |
|---|---|
| Taxon OID | 3300006640 Open in IMG/M |
| Scaffold ID | Ga0075527_10029121 Open in IMG/M |
| Source Dataset Name | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost305-11B |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1464 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Barrow Environmental Observatory site, Alaska | |||||||
| Coordinates | Lat. (o) | 71.299 | Long. (o) | -156.61 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F010884 | Metagenome / Metatranscriptome | 298 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075527_100291211 | F010884 | N/A | TQKEKEEEMVKQRFRVLFRRWFFTVAKFCGPILLFELFVLVRQHFQYVPPSISDLLMGALLAFLLTAVLCWLWALGEWLWFRLRRLRGFLGELRQCSRSYWNPEAVRTNKA* |
| ⦗Top⦘ |