


| Basic Information | |
|---|---|
| Taxon OID | 3300006562 Open in IMG/M |
| Scaffold ID | Ga0101390_1000618 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Black Sea in Odessa region - Od_2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Hellenic Centre for Marine Research (HCMR) |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1002 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Illichivsk, Odessa region, Ukraine | |||||||
| Coordinates | Lat. (o) | 46.302094 | Long. (o) | 30.668915 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088867 | Metagenome / Metatranscriptome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101390_10006181 | F088867 | GAG | MMEEDEPLSSSEAPRAPALDTEEGLSTPVAGPETPFRPTSGMPGLTPTGAHVTALQFDEEQVLRGLFCVCDELQACCEHATGMLQML* |
| ⦗Top⦘ |