NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0101391_1000393

Scaffold Ga0101391_1000393


Overview

Basic Information
Taxon OID3300006559 Open in IMG/M
Scaffold IDGa0101391_1000393 Open in IMG/M
Source Dataset NameMarine microbial communities from the Black Sea in Odessa region - Od_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHellenic Centre for Marine Research (HCMR)
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)796
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Apicomplexa → Aconoidasida → Haemosporida → Plasmodiidae → Plasmodium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Investigation Of Black Sea Water Bacterial Metagenome

Source Dataset Sampling Location
Location NameOdessa, Odessa region, Ukraine
CoordinatesLat. (o)46.440968Long. (o)30.772294Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001926Metagenome / Metatranscriptome616Y

Sequences

Protein IDFamilyRBSSequence
Ga0101391_10003931F001926N/AVRHEDIPDINNPKIRYAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERITKRYERERIKIEKLFTLGYTTSGDP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.