


| Basic Information | |
|---|---|
| Taxon OID | 3300006421 Open in IMG/M |
| Scaffold ID | Ga0082247_10758688 Open in IMG/M |
| Source Dataset Name | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten I |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Center for Biotechnology (CeBiTec), Bielefeld Univeristy |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 537 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Bacterial And Archaeal Communities |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fram Strait | |||||||
| Coordinates | Lat. (o) | 78.153207 | Long. (o) | 5.975413 | Alt. (m) | Depth (m) | 1200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034189 | Metagenome / Metatranscriptome | 175 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082247_107586882 | F034189 | AGGAG | MTTKLVKWASNVGQITKSEQADGRRAKFLPSVVGLAYDWLRFECYLGNFGSVSSSRKQSQFI* |
| ⦗Top⦘ |