


| Basic Information | |
|---|---|
| Taxon OID | 3300006395 Open in IMG/M |
| Scaffold ID | Ga0079066_1028384 Open in IMG/M |
| Source Dataset Name | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 506 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Urbana, Illinois, USA | |||||||
| Coordinates | Lat. (o) | 40.1191 | Long. (o) | -88.1952 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047076 | Metagenome / Metatranscriptome | 150 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079066_10283841 | F047076 | N/A | MTNGELLALAQLIVPELTAKAFVQFYNIAFEKISREVRLLTTVLRPTSVSLYKNLLEQNAVKIDSVKDASGDDIFWEVRHRKLLIYDSNKELITDATIGNHKLEIEYWVRISKATKLSFPTDDDIESNPNIIEEWNELIPGVEDTEVQLCALYLMITELAGIF |
| ⦗Top⦘ |