


| Basic Information | |
|---|---|
| Taxon OID | 3300006225 Open in IMG/M |
| Scaffold ID | Ga0082206_135208 Open in IMG/M |
| Source Dataset Name | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Norwegian Sequencing Centre (NSC) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 774 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor → Biogas Reactor Microbial Communities From Swedish University Of Agricultural Sciences, Alnarp, Sweden, And As, Norway That Are Enriched On Cellulose |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Alnarp, Sweden | |||||||
| Coordinates | Lat. (o) | 59.8152338 | Long. (o) | 17.6620518 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009968 | Metagenome / Metatranscriptome | 310 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082206_1352081 | F009968 | N/A | PGTPGAPGRTARRGASVRPNSCIGCRSHYRERHWWIFVIDFCGLDGDVVGFECPIGCIDTEGCSAYERRPAWPEGAIA* |
| ⦗Top⦘ |