


| Basic Information | |
|---|---|
| Taxon OID | 3300006164 Open in IMG/M |
| Scaffold ID | Ga0075441_10096926 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1133 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean: West Antarctic Peninsula | |||||||
| Coordinates | Lat. (o) | -64.8156 | Long. (o) | -64.0406 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053560 | Metagenome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0075441_100969261 | F053560 | AGGA | MAVQQITGKRITKYDTSNPNFVEKPKPQVEASGNVNDDSDIYGEKKHTYTPEPNGNLQVEQMMGKLMNKLDNFDSKSQTGIKAIEVDIKKEIAIGKADMS |
| ⦗Top⦘ |