


| Basic Information | |
|---|---|
| Taxon OID | 3300006159 Open in IMG/M |
| Scaffold ID | Ga0082047_10474 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Red Sea brine-pool interfase layer Discovery Deep |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | King Abdullah University of Science and Technology |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 993 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Red Sea Brine-Pools |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Red Sea | |||||||
| Coordinates | Lat. (o) | 21.28639 | Long. (o) | 38.28722 | Alt. (m) | Depth (m) | 2038 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F052244 | Metagenome | 143 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0082047_104743 | F052244 | GGGGG | MSNSMKDRLRTEIYLLLLTLALSLVVAIITFYIVAGTWARIDRGLDQIDNMLACMKGCSP |
| ⦗Top⦘ |